Protein coding transcript 252651

• Transcript: Ll_transcript_178989
• CDS coordinates: 954-1667 (+)
• Peptide sequence: MKLYAESLARFQGGSPYIYPLYGLGELPQGFARLSAVYGGTYMLNKPECKVEFDENGKAIGVTSEGETAKCKKVVCDPSYLPTKVKKVGKVNRAICIMSHPIPSTHDSPSVQVILPQKQLGRKSDMYLFCCSYSHNVAPKGKYIAFVTTEAETDNPQEELKPGIDLLGPVDEIFFDCYDRYEPTNQNDVDSCFISTSYDATTHFETTVRDVIAIYNKITGKELDLSVDLSAASAAEE*
• ORF Type: complete

Annotations of Ll_transcript_178989

• Blastp: Guanosine nucleotide diphosphate dissociation inhibitor 2 from Arabidopsis with 84.81% of identity
• Blastx: Guanosine nucleotide diphosphate dissociation inhibitor 2 from Arabidopsis with 82.42% of identity
• Eggnog: GDP dissociation inhibitor(COG5044)
• Kegg: Link to kegg annotations (AT3G59920)
• CantataDB: Link to cantataDB annotations (CNT0002686)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445391.1)
• Pfam: GDP dissociation inhibitor (PF00996.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;