Transcript | Ll_transcript_176895 |
---|---|
CDS coordinates | 178-1053 (+) |
Peptide sequence | MGTENPSRPSFPARPASSPFAAAQTMTPFSSTGPASGSDPTSFRPTPPAPPQTSTPFSLPGGPMVRPGLPSFRPGPPGRFNDPSVPPPPPPTSNVPPPGGPFQHYPGQQFSATAPQAPPPRATSMMGQPPFQHPVNQAPSFPASLPPQSQAPFVPMGSPPPGATPAPLGSNGPPPVYQPSFPGYARQQPGAEMQAPPPMHSPLPGNQGHYGSVPPVTSSSFLPHQGQGGYVPSPPLAAPLGIHPAQQLGSGPPVGSTQGLAEAFSSLTMQTRPGTMDTLFDAKEPPRPLDGD |
ORF Type | 3prime_partial |
Blastp | Protein transport protein Sec24-like At3g07100 from Arabidopsis with 34.32% of identity |
---|---|
Blastx | - |
Eggnog | SEC24 family, member(COG5028) |
Kegg | Link to kegg annotations (AT3G07100) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419201.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer