Protein coding transcript 252687

• Transcript: Ll_transcript_176894
• CDS coordinates: 157-837 (+)
• Peptide sequence: MVGMDCQNPQGNFIYRITSGIGSFWWIASDVQPTVSLEVVAQTIKSCLDELPGFPRTQIGFATFDSTIHFYNMKSSLTQPQMLVVSDLDDIFIPLPDDLLVNLSESRSVVETFLDSLPSMFQDNVNLESAFGPALKAAFMVMSQLGGKLLIFQNSLPSLGVGRLKLRGDDSRVYGTDKEHGLRLPEDPFYKQTAAEFSKYQISANVYAFSDKYTDIASLGTLAKYTA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_176894

• Blastp: Protein transport protein Sec24-like At3g07100 from Arabidopsis with 84.29% of identity
• Blastx: Protein transport protein Sec24-like At3g07100 from Arabidopsis with 84.29% of identity
• Eggnog: SEC24 family, member(COG5028)
• Kegg: Link to kegg annotations (AT3G07100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419201.1)
• Pfam: Sec23/Sec24 trunk domain (PF04811.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;