Protein coding transcript 252700

• Transcript: Ll_transcript_177431
• CDS coordinates: 163-936 (+)
• Peptide sequence: MSNNPQFPGLQPLRPPIGGSGDPQRNFAPPMHIQYRHVVPTQQSQQFIPMPSQHYQPTGHGVPMINVGMPPQNPNPQFSQPIQQLPPRHSQPMPLPPQAIPLPAARPNLHMLSEPKMAQADSQAPNGYTPGLGGSGTPLSSSYTFAPSSYGQMQTNFVSTGQYQSVPHTGSSQSITSGTFIQSNGEQPSVTNAMASATNLQPPPAMNDSTDWIEHTSATGRRFYYNKKTKLSSWEKPYELMTLVEAATINLDFYLLL*
• ORF Type: complete

Annotations of Ll_transcript_177431

• Blastp: Pre-mRNA-processing protein 40B from Arabidopsis with 36.43% of identity
• Blastx: Pre-mRNA-processing protein 40B from Arabidopsis with 38.62% of identity
• Eggnog: PRP40 pre-mRNA processing factor 40 homolog(COG5104)
• Kegg: Link to kegg annotations (AT3G19670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428119.1)
• Pfam: WW domain (PF00397.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;