Protein coding transcript 252733

• Transcript: Ll_transcript_178976
• CDS coordinates: 69-596 (+)
• Peptide sequence: MIQLMILVDHAGGIIPEINHSPWNGLTLADYVMPCFLFIVGVSLALTYKKLPCRVFASRKAIFRALKLFALGLFLQGGFFHGVNDLTYGVDIKRIRLMGILQRIAVAYLLTALCEIWLKCDDIVHSGSSLLWKYRYHGFVALFLTCIYLCLLYGSYVPDWEYQILIDSFSAPKIYS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_178976

• Blastp: Heparan-alpha-glucosaminide N-acetyltransferase from Mus with 31.9% of identity
• Blastx: Heparan-alpha-glucosaminide N-acetyltransferase from Homo with 32.76% of identity
• Eggnog: heparan-alpha-glucosaminide n-acetyltransferase(COG4299)
• Kegg: Link to kegg annotations (52120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441570.1)
• Pfam: Protein of unknown function (DUF1624) (PF07786.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;