Transcript | Ll_transcript_178979 |
---|---|
CDS coordinates | 82-651 (+) |
Peptide sequence | MDRRLVSLDVFRGLTVALMILVDHAGGIIPEINHSPWNGLTLADYVMPCFLFIVGVSLALTYKKLPCRVFASRKAIFRALKLFALGLFLQGGFFHGVNDLTYGVDIKRIRLMGILQRIAVAYLLTALCEIWLKCDDIVHSGSSLLWKYRYHGFVALFLTCIYLCLLYGSYVPDWEYQILIDSFSAPKIYS |
ORF Type | 3prime_partial |
Blastp | Heparan-alpha-glucosaminide N-acetyltransferase from Mus with 33.59% of identity |
---|---|
Blastx | Heparan-alpha-glucosaminide N-acetyltransferase from Homo with 33.82% of identity |
Eggnog | heparan-alpha-glucosaminide n-acetyltransferase(COG4299) |
Kegg | Link to kegg annotations (52120) |
CantataDB | Link to cantataDB annotations (CNT0002979) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441570.1) |
Pfam | Protein of unknown function (DUF1624) (PF07786.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer