Protein coding transcript 252741

• Transcript: Ll_transcript_178344
• CDS coordinates: 1137-1631 (+)
• Peptide sequence: MELAGQLFDMLKAVGKHHNFCVGLLIGGRKDVDVEKERVNELNILICTPGRLLQHMDETPNFDCSQMQVLVLHEADRILESGFKRELNAIISQLPKRRQTLLFSATQTKSVQDLARLSLKDPKYLSVHKESVTTTPTLLKQIVMVVPLDQKLDMLWSFIKTHLQ*
• ORF Type: complete

Annotations of Ll_transcript_178344

• Blastp: DEAD-box ATP-dependent RNA helicase 32 from Arabidopsis with 72.22% of identity
• Blastx: DEAD-box ATP-dependent RNA helicase 32 from Arabidopsis with 70% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (AT5G54910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417514.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;