Protein coding transcript 252756

• Transcript: Ll_transcript_179280
• CDS coordinates: 298-1698 (+)
• Peptide sequence: MASLSLSLPDLYFLSPLNHRVSLSKPPSRNSVSRNPTQYCGVTLRTRVRAVKEEGAVVEERVNDVKWSGNGFAGSSGGSNGSVKRSRLVVKESELVKYVNGNGVAAAKGVEVEGNAEDGRKKRVEEIGKEDAWFKQSGESQVEVAAAPGGRWSRFKTYSTIQRTLEIWGFVVTFIFKSWLNNQKFSYRGGMTEEKKTLRRKILAKWLKESILRLGPTFIKIGQQFSTRVDILPQEYVDQLSELQDQVPPFPSETAVAIIEEELGSPIDGIFDQFDYEPIAAASLGQVHRAKLKGQDVVVKVQRPGLKGLFDIDLKNLRVIAEYLQKVDPKSDGAKRDWVAIYDECASVLYQEIDYTKEATNAELFASNFKNMSYVKVPSIVWDYTTPQILTMEYVPGIKINKIQALDQLGVDRTRLGRYAVESYLEQILSHGFFHADPHPGNIAVDDVNGGRLIFYDFGMMGRYVL*
• ORF Type: complete

Annotations of Ll_transcript_179280

• Blastp: Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic from Arabidopsis with 74.32% of identity
• Blastx: Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic from Arabidopsis with 74.61% of identity
• Eggnog: Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661)
• Kegg: Link to kegg annotations (AT5G64940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462413.1)
• Pfam: ABC1 family (PF03109.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;