Protein coding transcript 252835

• Transcript: Ll_transcript_178240
• CDS coordinates: 307-885 (+)
• Peptide sequence: MKGFLWFAYRENAGLLALTRVGSRRVVQISAGFMIFFSILGKFGAVFASIPPSIIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFVLGFSIFLGLSVAQYFNEYQAINGFGPVHTGARWFNDIINVPFQSKAFVAGIVAYFLDNTLHKKEGAIRKDRGKHWWDKYKSFKGDTRSEEFYSLPFNLNKYFPSV*
• ORF Type: complete

Annotations of Ll_transcript_178240

• Blastp: Nucleobase-ascorbate transporter 6 from Arabidopsis with 87.91% of identity
• Blastx: Nucleobase-ascorbate transporter 6 from Arabidopsis with 87.91% of identity
• Eggnog: permease(COG2233)
• Kegg: Link to kegg annotations (AT5G62890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463856.1)
• Pfam: Permease family (PF00860.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;