Protein coding transcript 252900

• Transcript: Ll_transcript_177089
• CDS coordinates: 74-802 (+)
• Peptide sequence: MAGITTTTTTLLLHSQINKPSPLSSSHSKLFGFTFSIPKSHSSVSLTSVNVTSRYGGGGGGSRNFDYRRKNNDDDDDEEALDISSLRSGTVRLIDQAQNMVGVVSRSQAIQMAEDAELDLVIVSPDADPPVVRIMDYSKYKYEIQKKKRGQQKKSAASRMDLKELKMGYNIDQHDYSVRLRAAQKFLKDGDKVKIIVNLKGRENEFRNIATELLRRFQNDVGEVCIATSLYYDYLTSDFLSI*
• ORF Type: complete

Annotations of Ll_transcript_177089

• Blastp: Translation initiation factor IF3-4, chloroplastic from Arabidopsis with 58.8% of identity
• Blastx: Translation initiation factor IF3-2, chloroplastic from Arabidopsis with 72.37% of identity
• Eggnog: IF-3 binds to the 30S ribosomal subunit and shifts the equilibrum between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enhancing the availability of 30S subunits on which protein synthesis initiation begins (By similarity)(COG0290)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453667.1)
• Pfam: Translation initiation factor IF-3, N-terminal domain (PF05198.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;