Transcript | Ll_transcript_391596 |
---|---|
CDS coordinates | 383-706 (+) |
Peptide sequence | MLGPDYSTKFSPWLASGSLSPRFIHEEVKRYENERQANSSTYWVLFELIWRDYFRFLSVKYGNSLFHLGGPRKVQRSWSQDRNLFESWKDGRTGYIFLFKMISPYIKS |
ORF Type | 3prime_partial |
Blastp | Cryptochrome DASH, chloroplastic/mitochondrial from Oryza sativa with 80.61% of identity |
---|---|
Blastx | Cryptochrome DASH, chloroplastic/mitochondrial from Oryza sativa with 82.08% of identity |
Eggnog | deoxyribo-dipyrimidine photolyase(COG0415) |
Kegg | Link to kegg annotations (4341749) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437682.1) |
Pfam | FAD binding domain of DNA photolyase (PF03441.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer