| Transcript | Ll_transcript_391610 |
|---|---|
| CDS coordinates | 3-329 (+) |
| Peptide sequence | EFSSSESELFYGVQKPKPIRTSFSYEKTNFEKTQKPKHHENNGFGKPKSKALRILYGDLKKPISPGAKLASFVNSLFTSSGNAKKTKLSSSSSSSSSSRSSHVHEGSKS |
| ORF Type | internal |
| Blastp | Protein BIG GRAIN 1-like B from Arabidopsis with 47.06% of identity |
|---|---|
| Blastx | Protein BIG GRAIN 1-like B from Arabidopsis with 47.06% of identity |
| Eggnog | NA(ENOG410YYWK) |
| Kegg | Link to kegg annotations (AT1G54200) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425440.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer