Protein coding transcript 2530

• Transcript: Ll_transcript_328907
• CDS coordinates: 119-442 (+)
• Peptide sequence: MEDLIASSSSSSFVSLLKENPATLPQRLQVLVESQLDWWVYAIFWQTKKDENDNLYLSWGEGYFQGTKEITPTLQQLSNTCSNDKDQNEDAEWFYIMSLTRTFSITNA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_328907

• Blastp: Transcription factor MYC2 from Arabidopsis with 31.58% of identity
• Blastx: Transcription factor MYC2 from Arabidopsis with 31.58% of identity
• Eggnog: anthocyanin-containing compound biosynthetic process(ENOG410YCJJ)
• Kegg: Link to kegg annotations (AT1G32640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456812.1)
• Pfam: bHLH-MYC and R2R3-MYB transcription factors N-terminal (PF14215.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;