Protein coding transcript 253001

• Transcript: Ll_transcript_178081
• CDS coordinates: 3-362 (+)
• Peptide sequence: KDLSTPFSASFSLTLKFDQFTNLASYCILFLISCPFSSRFDAVIHFAGLKAVGESVHKPLVYYDNNLIGTIILFEVMAAHGCKKLVFSSSATVYGWPKEVPCTEEFPLSAANPYGRTKV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_178081

• Blastp: UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 90.36% of identity
• Blastx: UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 88.37% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446510.1)
• Pfam: GDP-mannose 4,6 dehydratase (PF16363.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;