Protein coding transcript 253002

• Transcript: Ll_transcript_178083
• CDS coordinates: 240-719 (+)
• Peptide sequence: MAVKTVLVTGGAGYIGSHTVLQLLLGGYKVVVVDNLDNSSETAIKRVKELAGKSKSNISFYKLDLRDRSALDKVFSSKKFDAVIHFAGLKAVGESVHKPLVYYDNNLIGTIILFEVMAAHGCKKLVFSSSATVYGWPKEVPCTEEFPLSAANPYGRTKV*
• ORF Type: complete

Annotations of Ll_transcript_178083

• Blastp: UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 86.79% of identity
• Blastx: UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 85.8% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446510.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;