Transcript | Ll_transcript_178086 |
---|---|
CDS coordinates | 1-537 (+) |
Peptide sequence | FEVMAAHGCKKLVFSSSATVYGWPKEVPCTEEFPLSAANPYGRTKLIIEEICRDIYKAESEWKIILLRYFNPVGAHPSGSIGEDPRGIPNNLMPFVQQVAVGRRPALTVFGNDYNTVDGTGVRDYIHVVDLADGHIAALLKLDESNIGCEVYNLGTGKGTSVLEMVRAFELASGKVID* |
ORF Type | 5prime_partial |
Blastp | UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 92.09% of identity |
---|---|
Blastx | UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 92.09% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017408013.1) |
Pfam | NAD dependent epimerase/dehydratase family (PF01370.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer