Protein coding transcript 253007

• Transcript: Ll_transcript_178091
• CDS coordinates: 955-1380 (+)
• Peptide sequence: MISGERFFFQLIIEEICRDVYNADQDWKIILLRYFNPVGAHPSGYIGEDPRGIPNNLMPFVQQVAVGRLPALKVFGTDYKTRDGTGIRDYIHVVDLADGHIAALNKLDDPNIGCEVYNLGTGKGTSVLEMVKAFEQASEKKI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_178091

• Blastp: UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 88.72% of identity
• Blastx: UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 78.86% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424484.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;