Protein coding transcript 253011

• Transcript: Ll_transcript_178074
• CDS coordinates: 79-516 (+)
• Peptide sequence: MFSLFLTCVVVLVNFLFLQMIFLQNEVILILFGSSQIRDYIHVVDLADGHIAALNKLDDPNIGIIQNYQFSESLQCCKLMLDSSNPIIFIFIFEGEVMDFVLMQCYCGKTLYCWYTGCEVYNLGTGKGTSVLEMVKAFEQASEKKI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_178074

• Blastp: UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 40.15% of identity
• Blastx: Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 from Arabidopsis with 39.82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422623.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;