Protein coding transcript 253012

• Transcript: Ll_transcript_178075
• CDS coordinates: 115-912 (+)
• Peptide sequence: MSPKTVLVTGGAGYIGSHTVLQLLRGGYNAVVVDNLDNSSEVAIHRVKELAGEFKANLSFYKLDLRDRAALEKVFASTKFDAVIHFAGLKAVGESVQKPLLYYDNNLIGTIILFEVMAAHGCKKLVFSSSATVYGWPKEVPCTEEFPLSAANPYGRTKLIIEEICRDIYHGESEWKIILLRYFNPVGAHPSGAIGEDPRGIPNNLMPFVQQVAVGRRPALTVFGTDYNTSDGTGVRDYIHVVDLADGHIAALNKLDDPKIGCEVYN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_178075

• Blastp: UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 90.98% of identity
• Blastx: UDP-glucose 4-epimerase GEPI48 from Cyamopsis with 90.98% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422623.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;