Protein coding transcript 253036

• Transcript: Ll_transcript_178775
• CDS coordinates: 134-442 (+)
• Peptide sequence: MQAETSWALTVLGYLAKLVLGILGLIVSVAWVAHIIIYLLIDPPLSPFLNEVFIKLDDVWGMLKYPLFFIFPQILLMIDTLHDNIHSVTLFSICILLFYQAFL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_178775

• Blastp: LIMR family protein At5g01460 from Arabidopsis with 82.86% of identity
• Blastx: LIMR family protein At3g08930 from Arabidopsis with 77.03% of identity
• Eggnog: LIMR family(ENOG410XRDU)
• Kegg: Link to kegg annotations (AT5G01460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413976.1)
• Pfam: LMBR1-like membrane protein (PF04791.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;