Transcript | Ll_transcript_179447 |
---|---|
CDS coordinates | 1568-2014 (+) |
Peptide sequence | MVDPWEANQSTYQRTLTVLSRVQSSICETGLVSRESLKVMLVCGSDLLQSFGIPGFWIRDQVKAISRDYGVVCISREGQDVGIIISSDDILNENQANIKVVDELVPNQISSTRVRECIARGLSIKYLTADEVIDYIREQQLYSHSDDK* |
ORF Type | complete |
Blastp | Nicotinamide/nicotinic acid mononucleotide adenylyltransferase from Arabidopsis with 67.13% of identity |
---|---|
Blastx | Nicotinamide/nicotinic acid mononucleotide adenylyltransferase from Arabidopsis with 65.06% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT5G55810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421187.1) |
Pfam | Cytidylyltransferase-like (PF01467.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer