Protein coding transcript 253073

• Transcript: Ll_transcript_179450
• CDS coordinates: 1568-2014 (+)
• Peptide sequence: MVDPWEANQSTYQRTLTVLSRVQSSICETGLVSRESLKVMLVCGSDLLQSFGIPGFWIRDQVKAISRDYGVVCISREGQDVGIIISSDDILNENQANIKVVDELVPNQISSTRVRECIARGLSIKYLTADEVIDYIREQQLYSHSDDK*
• ORF Type: complete

Annotations of Ll_transcript_179450

• Blastp: Nicotinamide/nicotinic acid mononucleotide adenylyltransferase from Arabidopsis with 67.13% of identity
• Blastx: Nicotinamide/nicotinic acid mononucleotide adenylyltransferase from Arabidopsis with 65.06% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G55810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421187.1)
• Pfam: Cytidylyltransferase-like (PF01467.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;