Transcript | Ll_transcript_179250 |
---|---|
CDS coordinates | 1-390 (+) |
Peptide sequence | LFQEQKLPQGLIKAIKLDVLNEADIDKIAALEINAAGQVNCSDLGLPNLSSECTTCGGKSSDKNSCEGHYGVIKFPFVILHPYFMSEIAKILNKICPGCKSIRRELQNKLKYKSTYLWSLLLSSDHLNK* |
ORF Type | 5prime_partial |
Blastp | DNA-directed RNA polymerase IV subunit 1 from Arabidopsis with 49.51% of identity |
---|---|
Blastx | DNA-directed RNA polymerase IV subunit 1 from Arabidopsis with 49.51% of identity |
Eggnog | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0086) |
Kegg | Link to kegg annotations (AT1G63020) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445104.1) |
Pfam | RNA polymerase Rpb1, domain 1 (PF04997.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer