Protein coding transcript 25322

• Transcript: Ll_transcript_391618
• CDS coordinates: 191-871 (+)
• Peptide sequence: MFSLCSNPFIYPTSSFSPHSPFLLSFHFFTNPCTLHPRFSALKVSASEGDNVLGKPLIQQGKEFTTILDEKGDDDIIPMKKTKAYAYEEVEDDDDDDDVEEEKWVDWEDQILEDTVPLVGFVRMILHSGKYESGERLTPEHEKVILEKLLPFHPEHAKKIGCGIDYITIGYHPNFDRSRCLFIVRKDGELVDFSFWKCIKGLIRKNYPLYADSFILRHFRKRSPSL*
• ORF Type: complete

Annotations of Ll_transcript_391618

• Blastp: Protein DCL, chloroplastic from Lycopersicon with 75.56% of identity
• Blastx: Protein DCL, chloroplastic from Lycopersicon with 81.42% of identity
• Eggnog: Protein of unknown function (DUF3223)(ENOG410YGK0)
• Kegg: Link to kegg annotations (544019)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433112.1)
• Pfam: Protein of unknown function (DUF3223) (PF11523.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;