Protein coding transcript 253248

• Transcript: Ll_transcript_179412
• CDS coordinates: 504-1004 (+)
• Peptide sequence: MPELRSGARRSKRLGDLQPGPLPVDQGENWVQPPAQNRTRRRVGGGRGRGANATAVGKGPSPAVPTRRTAAGRGRGARVINLDPEPCDVLPEPVALGAPEPIYNNVEVVANNNIVMEGGSGDKAVAAEEEASTTPVPERVFPYCLLPLLDCITAFPKYCCNLVFMM*
• ORF Type: complete

Annotations of Ll_transcript_179412

• Blastp: Casein kinase 1-like protein HD16 from Oryza sativa with 37.91% of identity
• Blastx: Casein kinase 1-like protein HD16 from Oryza sativa with 83.08% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (4334396)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429649.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;