Protein coding transcript 253264

• Transcript: Ll_transcript_179211
• CDS coordinates: 494-1180 (+)
• Peptide sequence: MWRRKSSPLHDMEKHCNVEIAAQVSRLPSSKHGGDSFHLEGLMESPSVEDDGECFSPLQLNASSVNVEAYYSKAVNYTLMVTFVSLLQVLLLIRQMEHSNTQSGAAKVSILMVGQQAIMDAYLCLLHLTAGIVVESLFNAFATAAFFKFVVFSIFEMRYILVVWKASRPLSNGEGWETMRRELSALYRRLCKCTNFELKFPLQSDFFTVVCHDWLHWIHDRTDISLTI*
• ORF Type: complete

Annotations of Ll_transcript_179211

• Blastp: DSC E3 ubiquitin ligase complex subunit 1 from Schizosaccharomyces with 30.77% of identity
• Blastx: -
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC947.10)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464855.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;