Protein coding transcript 253265

• Transcript: Ll_transcript_179212
• CDS coordinates: 1762-2337 (+)
• Peptide sequence: MESPSVEDDGECFSPLQLNASSVNVEAYYSKAVNYTLMVTFVSLLQVLLLIRQMEHSNTQSGAAKVSILMVGQQAIMDAYLCLLHLTAGIVVESLFNAFATAAFFKFVVFSIFEMRYILVVWKASRPLSNGEGWETMRRELSALYRRLCKCTNFELKFPLQSDFFTVVCHPLIGSVITLCYFLNDLSHLTV*
• ORF Type: complete

Annotations of Ll_transcript_179212

• Blastp: DSC E3 ubiquitin ligase complex subunit 1 from Schizosaccharomyces with 31.46% of identity
• Blastx: Transmembrane E3 ubiquitin-protein ligase 1 from Saccharomyces with 31.82% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC947.10)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453710.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;