Transcript | Ll_transcript_179216 |
---|---|
CDS coordinates | 1762-2754 (+) |
Peptide sequence | MESPSVEDDGECFSPLQLNASSVNVEAYYSKAVNYTLMVTFVSLLQVLLLIRQMEHSNTQSGAAKVSILMVGQQAIMDAYLCLLHLTAGIVVESLFNAFATAAFFKFVVFSIFEMRYILVVWKASRPLSNGEGWETMRRELSALYRRLSGILFAGILLMYEFHYYLKPILLLVYSFWIPQIITNVVRDSRKPLHPHYIIGMTVTRLAIPLYIFCCPDNFMRIEPDQRWCVYLTVFVGLQAAILLLQHYLGSRCFIPHQILPEKYSYYRRFAQDTSHAADCVICMTTIDLSPPSNDCMVTPCDHFFHSVCLQRWMDIKMECPTCRRPLPPA* |
ORF Type | complete |
Blastp | Transmembrane E3 ubiquitin-protein ligase 1 from Saccharomyces with 28.98% of identity |
---|---|
Blastx | Transmembrane E3 ubiquitin-protein ligase 1 from Saccharomyces with 28.98% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YKL034W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464855.1) |
Pfam | Ring finger domain (PF13639.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer