Transcript | Ll_transcript_178186 |
---|---|
CDS coordinates | 3-674 (+) |
Peptide sequence | KKVFGVFGPITSAVVMRDEDGKSKCFGFVNFENTDDAAQAVEALNGKKFDDKEWYVGKAQKKSERDHELKLKFEQSMKEAADKYQGANLYVKNLDDSIGDEKLKELFSPFGTITSSKVMREPSGISRGSGFVAFSTPEEASRALLEMNGKMVVSKPLYVTLAQRKEDRRARLQAQFSQMRPVTIAPSVAPRVPMYPPGGPGIGQQIFYGQGPPAMIPSQPGFGY |
ORF Type | internal |
Blastp | Polyadenylate-binding protein 8 from Arabidopsis with 78.57% of identity |
---|---|
Blastx | Polyadenylate-binding protein 8 from Arabidopsis with 78.57% of identity |
Eggnog | poly(A) binding protein, cytoplasmic(ENOG410XR5X) |
Kegg | Link to kegg annotations (AT1G49760) |
CantataDB | Link to cantataDB annotations (CNT0002568) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445806.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer