Protein coding transcript 253336

• Transcript: Ll_transcript_179014
• CDS coordinates: 199-657 (+)
• Peptide sequence: MADTETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDAQPELFIHLVPDKTNNSLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQFGVGFYSAYLAADKVIVTTKHNDDEQYVWESPA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_179014

• Blastp: Heat shock protein 90-2 from Arabidopsis with 92.81% of identity
• Blastx: Heat shock protein 90-4 from Arabidopsis with 92.81% of identity
• Eggnog: Molecular chaperone. Has ATPase activity (By similarity)(COG0326)
• Kegg: Link to kegg annotations (AT5G56030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435703.1)
• Pfam: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF13589.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;