Protein coding transcript 25345

• Transcript: Ll_transcript_390084
• CDS coordinates: 1225-1950 (+)
• Peptide sequence: MDLKAQISTLVQKGKEMSKAETEAGDAGPVVTEVDIQHIVSSWTGIPVEKVSTDESDRLLKMEDTLHKRIIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGLDLDYDEKD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_390084

• Blastp: Chaperone protein ClpC, chloroplastic from Pisum with 95.45% of identity
• Blastx: Chaperone protein ClpC, chloroplastic from Pisum with 94.09% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430101.1)
• Pfam: Sigma-54 interaction domain (PF00158.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;