Protein coding transcript 25346

• Transcript: Ll_transcript_390086
• CDS coordinates: 28-579 (+)
• Peptide sequence: MGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPTVDETIQILKGLRERYEIHHKLRYTDEALVAAAQLSYQYIRFVILPFCFFCVHFPLVIYARIDIFLIKYSKVAYLHSISSTELS*
• ORF Type: complete

Annotations of Ll_transcript_390086

• Blastp: Chaperone protein ClpC1, chloroplastic from Arabidopsis with 95.45% of identity
• Blastx: Chaperone protein ClpC1, chloroplastic from Arabidopsis with 95.45% of identity
• Eggnog: ATP-dependent CLP protease ATP-binding subunit(COG0542)
• Kegg: Link to kegg annotations (AT5G50920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003523172.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;