Protein coding transcript 25351

• Transcript: Ll_transcript_390078
• CDS coordinates: 68-673 (+)
• Peptide sequence: MGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPTVDETIQILKGLRERYEIHHKLRYTDEALVAAAQLSYQYISDRFLPDKAIDLVDEAGSRVRLQHAQLPEEARVLDKEVRQIVKEKEEAVRNQDFETAGELRDR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_390078

• Blastp: Chaperone protein ClpC, chloroplastic from Pisum with 95.54% of identity
• Blastx: Chaperone protein ClpC, chloroplastic from Pisum with 95.54% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430101.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;