Transcript | Ll_transcript_179596 |
---|---|
CDS coordinates | 203-1444 (+) |
Peptide sequence | MAVETNDKTSLPLDFGDDDGPVTFKRYTSSKKKQLQSELTKSTSNSLDGQSNRQSSNVPSSNGQSSSTPKGDVVPSAKASAVKSPVGNSKASNSLVNPASVKLPVANSRSHSLNDKPKSVPEQKASIDIKEESKFIKHCTKDYAEDSEDEEDNKPLSARLKVNSNIDNKATPVVVKKSYEDSDDDDDIPLSAKLFRNSNVGTSSGNYDDPDEKKPISKVQKERQNGSSASNKQGKPSTVPAKRPLDKSNSVHSPVKKSKVSDPAASIKTKQVSLKCEPKVDDDDDDDIPISQRIKKSATSADKSSSINKKAATSADKSSSIKKNLAKVTKVNKAGKTSFKKQPKKLKKSGKGSDYSKSMKFLPGSGDGQKKWTTLVHNGVIFPPLYQPHGVKMLYKGKPVDLTPDQEEVGFYL* |
ORF Type | complete |
Blastp | DNA topoisomerase 1 alpha from Arabidopsis with 41.18% of identity |
---|---|
Blastx | DNA topoisomerase 1 alpha from Arabidopsis with 84.44% of identity |
Eggnog | Dna topoisomerase(COG3569) |
Kegg | Link to kegg annotations (AT5G55300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413101.1) |
Pfam | Eukaryotic DNA topoisomerase I, DNA binding fragment (PF02919.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer