Protein coding transcript 253535

• Transcript: Ll_transcript_179612
• CDS coordinates: 158-547 (+)
• Peptide sequence: MFAVMRDTDYMQKDKFKENFWTDWRKLLGKNHVIQNLNDCDFTPIYDWCQSEKEKKRQMSSEEKKAQKEERAKLEEKYMWAIVDGVKEKVGNFRVEPPGLFRGRGEHPKMGKLKKRICPNDITINIGKDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_179612

• Blastp: DNA topoisomerase 1 beta from Arabidopsis with 74.62% of identity
• Blastx: DNA topoisomerase 1 alpha from Arabidopsis with 75.69% of identity
• Eggnog: Dna topoisomerase(COG3569)
• Kegg: Link to kegg annotations (AT5G55310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431101.1)
• Pfam: Eukaryotic DNA topoisomerase I, DNA binding fragment (PF02919.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;