Transcript | Ll_transcript_179612 |
---|---|
CDS coordinates | 158-547 (+) |
Peptide sequence | MFAVMRDTDYMQKDKFKENFWTDWRKLLGKNHVIQNLNDCDFTPIYDWCQSEKEKKRQMSSEEKKAQKEERAKLEEKYMWAIVDGVKEKVGNFRVEPPGLFRGRGEHPKMGKLKKRICPNDITINIGKDA |
ORF Type | 3prime_partial |
Blastp | DNA topoisomerase 1 beta from Arabidopsis with 74.62% of identity |
---|---|
Blastx | DNA topoisomerase 1 alpha from Arabidopsis with 75.69% of identity |
Eggnog | Dna topoisomerase(COG3569) |
Kegg | Link to kegg annotations (AT5G55310) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431101.1) |
Pfam | Eukaryotic DNA topoisomerase I, DNA binding fragment (PF02919.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer