Protein coding transcript 25354

• Transcript: Ll_transcript_390081
• CDS coordinates: 68-835 (+)
• Peptide sequence: MGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPTVDETIQILKGLRERYEIHHKLRYTDEALVAAAQLSYQYISDRFLPDKAIDLVDEAGSRVRLRHAQLPEEARELDKEVRQIIKEKEEASRNQDFEKVMSFTFTGGSDLYIFSVKPYFSGRLSTIKEKEEPCCLKNNAFAQVQIKRLADFLFFIVLS*
• ORF Type: complete

Annotations of Ll_transcript_390081

• Blastp: Chaperone protein ClpC, chloroplastic from Pisum with 95.45% of identity
• Blastx: Chaperone protein ClpB from Leptolyngbya with 52.48% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016180331.1)
• Pfam: Sigma-54 interaction domain (PF00158.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;