Protein coding transcript 253546

• Transcript: Ll_transcript_178327
• CDS coordinates: 501-926 (+)
• Peptide sequence: MRSIKLHGRTDKVSRCLNLGSYNYLGFAAADEYCTPRVVESLEQYSPSTCSTRVDGGTTALHNELEDCVASFVRKPAALVFGMGYVTNSAILPVLMGKGSLIISDSLNHNSIVNGARGSGATIRVFLHNSECLCCIYHNKQ*
• ORF Type: complete

Annotations of Ll_transcript_178327

• Blastp: Long chain base biosynthesis protein 2a from Oryza sativa with 81.15% of identity
• Blastx: Long chain base biosynthesis protein 2a from Oryza sativa with 81.15% of identity
• Eggnog: 8-Amino-7-oxononanoate synthase(COG0156)
• Kegg: Link to kegg annotations (4350591)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013451618.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;