Transcript | Ll_transcript_178306 |
---|---|
CDS coordinates | 1189-1635 (+) |
Peptide sequence | MVIVEGIYSMEGELCKLPEVIGICKKYKVYTYLDEAHSIGAVGKTGRGVCELLDVDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSNRGAQKLAQIRENSNFFRSELQKMGFE |
ORF Type | 3prime_partial |
Blastp | Long chain base biosynthesis protein 2d from Oryza sativa with 87.92% of identity |
---|---|
Blastx | Long chain base biosynthesis protein 2a from Oryza sativa with 81.48% of identity |
Eggnog | 8-Amino-7-oxononanoate synthase(COG0156) |
Kegg | Link to kegg annotations (4326966) |
CantataDB | Link to cantataDB annotations (CNT0000176) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442913.1) |
Pfam | Aminotransferase class I and II (PF00155.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer