Protein coding transcript 253547

• Transcript: Ll_transcript_178306
• CDS coordinates: 1189-1635 (+)
• Peptide sequence: MVIVEGIYSMEGELCKLPEVIGICKKYKVYTYLDEAHSIGAVGKTGRGVCELLDVDTADVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSNRGAQKLAQIRENSNFFRSELQKMGFE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_178306

• Blastp: Long chain base biosynthesis protein 2d from Oryza sativa with 87.92% of identity
• Blastx: Long chain base biosynthesis protein 2a from Oryza sativa with 81.48% of identity
• Eggnog: 8-Amino-7-oxononanoate synthase(COG0156)
• Kegg: Link to kegg annotations (4326966)
• CantataDB: Link to cantataDB annotations (CNT0000176)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442913.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;