Transcript | Ll_transcript_178307 |
---|---|
CDS coordinates | 896-1807 (+) |
Peptide sequence | MGYVTNSAILPVLLGKGSLIISDSLNHNSIVNGARGSGATIRVFLHNTPQHLEEVLRELIAEGQPRTHRPWKKIMVIVEGIYSMEGELCKLPEIVAICKKYKVYTYLDEAHSIGAVGKTGRGVCELLDVDTSDVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSNRGAQKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLLLARARICISASHSKEDLVKALQVYIFNIIRVVTCF* |
ORF Type | complete |
Blastp | Long chain base biosynthesis protein 2d from Oryza sativa with 87.97% of identity |
---|---|
Blastx | Long chain base biosynthesis protein 2b from Arabidopsis with 84.7% of identity |
Eggnog | 8-Amino-7-oxononanoate synthase(COG0156) |
Kegg | Link to kegg annotations (4326966) |
CantataDB | Link to cantataDB annotations (CNT0000176) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442914.1) |
Pfam | Aminotransferase class I and II (PF00155.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer