Protein coding transcript 253553

• Transcript: Ll_transcript_178326
• CDS coordinates: 1013-1957 (+)
• Peptide sequence: MGYVTNSAILPVLLGKGSLIISDSLNHNSIVNGARGSGATIRVFLHNTPQHLEEVLRELIAEGQPRTHRPWKKIMVIVEGIYSMEGELCKLPEIVAICKKYKVYTYLDEAHSIGAVGKTGRGVCELLDVDTSDVDIMMGTFTKSFGSCGGYIAGSKELIQYLKYTCPAHLYATSISPPAAQQIISSIKVILGEDGSNRGAQKLAQIRENSNFFRSELQKMGFEVLGDNDSPVMPIMLYNPAKIPAFSRECLRQNVAVVTVAFPATPLLLARARICISASHSKEDLVKALQVINKVGDLVGIKYFLAEPIKQKFD*
• ORF Type: complete

Annotations of Ll_transcript_178326

• Blastp: Long chain base biosynthesis protein 2b from Arabidopsis with 86.31% of identity
• Blastx: Long chain base biosynthesis protein 2b from Arabidopsis with 75.7% of identity
• Eggnog: 8-Amino-7-oxononanoate synthase(COG0156)
• Kegg: Link to kegg annotations (AT3G48780)
• CantataDB: Link to cantataDB annotations (CNT0000176)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429069.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;