Transcript | Ll_transcript_178905 |
---|---|
CDS coordinates | 2-829 (+) |
Peptide sequence | FILPLLQHLTKGEDNVSSVKRRLALMFGISLRKTVPGEPDLAPIVDSCSEKSGGKFGDYQCNNAMVLWSKIKGKQREFKGPPAIGQAIVKNLPPSEMIESCSVAGPGFVNVVLSKDWIAQILLRMLIDGIDTWAPLLLLKTAVVDFSSPNIAKEMHVGNLRSTIIGDTLARMLEFSHVEVLRRNHVGDWGTQFGMLIEFLFEKFPITEEADEPDIGDLQAFYKASKLRFDSDPEFKQRAQQAVVRLQVDYTQRVFLFFYSRGGWRRQVSQGMETNL |
ORF Type | internal |
Blastp | Arginine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 69.87% of identity |
---|---|
Blastx | Arginine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 69.3% of identity |
Eggnog | arginyL-tRNA synthetase(COG0018) |
Kegg | Link to kegg annotations (AT4G26300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455444.1) |
Pfam | Arginyl tRNA synthetase N terminal domain (PF03485.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer