Protein coding transcript 253603

• Transcript: Ll_transcript_178905
• CDS coordinates: 2-829 (+)
• Peptide sequence: FILPLLQHLTKGEDNVSSVKRRLALMFGISLRKTVPGEPDLAPIVDSCSEKSGGKFGDYQCNNAMVLWSKIKGKQREFKGPPAIGQAIVKNLPPSEMIESCSVAGPGFVNVVLSKDWIAQILLRMLIDGIDTWAPLLLLKTAVVDFSSPNIAKEMHVGNLRSTIIGDTLARMLEFSHVEVLRRNHVGDWGTQFGMLIEFLFEKFPITEEADEPDIGDLQAFYKASKLRFDSDPEFKQRAQQAVVRLQVDYTQRVFLFFYSRGGWRRQVSQGMETNL
• ORF Type: internal

Annotations of Ll_transcript_178905

• Blastp: Arginine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 69.87% of identity
• Blastx: Arginine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 69.3% of identity
• Eggnog: arginyL-tRNA synthetase(COG0018)
• Kegg: Link to kegg annotations (AT4G26300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455444.1)
• Pfam: Arginyl tRNA synthetase N terminal domain (PF03485.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;