Protein coding transcript 253725

• Transcript: Ll_transcript_178287
• CDS coordinates: 262-861 (+)
• Peptide sequence: MASPNSVLVTTEKSTNDFTLLQVHDSDSQMFLEKKQKAASLKQFSWFLLLKLHKVLTCLSWLNTGFKSTFALVKKRISLSGISDEDPKYRGRLYRVIMVFLALSIGALVIEIIAHFNKWNLHSMMVKPFEVQSLLHWSYMAWLSFREDYVAPFVLLVSKFCIVLFMIQSLDRLVLCLGCFWIKFKKLKPFIEEDAYDVED
• ORF Type: 3prime_partial

Annotations of Ll_transcript_178287

• Blastp: Xyloglucan glycosyltransferase 4 from Arabidopsis with 55.78% of identity
• Blastx: Xyloglucan glycosyltransferase 4 from Arabidopsis with 55.78% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT3G28180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452895.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;