| Transcript | Ll_transcript_177334 |
|---|---|
| CDS coordinates | 80-463 (+) |
| Peptide sequence | MTKEVAEGFNFEQRHGKDKVRVARVWKNKQDGRYYVVEWRVTINLLSDCINSYVRDDNSDIVATDTMKNTVYAKAKECSEILSVEDFAIQLAKHFTSFYKQVTTAIVSIVEKPWERINVDGQPHEHG* |
| ORF Type | complete |
| Blastp | Uricase-2 isozyme 2 from Canavalia with 81.89% of identity |
|---|---|
| Blastx | Uricase-2 isozyme 2 from Canavalia with 81.89% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428249.1) |
| Pfam | Uricase (PF01014.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer