Protein coding transcript 253751

• Transcript: Ll_transcript_179696
• CDS coordinates: 338-997 (+)
• Peptide sequence: MLNMDPKQRLTAHEVLNHPWIKEDGEAPDTPLDNAVLNRLKQFRAMDQFKKVALKVIAGCLSEEEIMGLKQMFKGMDTDNSGTITIEELKQGLAKQGTKLTEQEVKQLMEAADADGNGLIDYDEFITATMHMNRMNRADHVYTAFQYFDKDNSGYITIEELEQALHEYDMHDGRDIKEIIAEVDADNDGRINYDEFVAMMTKGHAEAVPTKKRRDSFVS*
• ORF Type: complete

Annotations of Ll_transcript_179696

• Blastp: Calcium-dependent protein kinase 17 from Arabidopsis with 78.8% of identity
• Blastx: Calcium-dependent protein kinase 17 from Arabidopsis with 81.33% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT5G12180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434654.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;