Transcript | Ll_transcript_177149 |
---|---|
CDS coordinates | 1954-2337 (-) |
Peptide sequence | MESHIEDAEKYLEMPVIFAEFGVSSKDPGYNSSYRDNLINTVYKTILNSTKKGGSGAGSLVWQLFPDGTDYMDDGYAIILSKSPSTSSMISLQSTRLDIFNSVCSKRCHWGCKKKNVFQKVFYRDEL* |
ORF Type | complete |
Blastp | Mannan endo-1,4-beta-mannosidase 6 from Arabidopsis with 62.02% of identity |
---|---|
Blastx | Mannan endo-1,4-beta-mannosidase 6 from Arabidopsis with 60% of identity |
Eggnog | Mannan endo-1,4-beta-mannosidase(COG3934) |
Kegg | Link to kegg annotations (AT5G01930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464058.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer