Protein coding transcript 253768

• Transcript: Ll_transcript_177151
• CDS coordinates: 123-863 (+)
• Peptide sequence: MNIMASLLSPTTILKQHNQMTICFSPLKPTLPTYNNNVSFKSTSNSSKCHAFFDDISNGLLENGVIQSGIVQFERVTEDLSDMQRWSFVIFGGLTWIYLTARPGVLVGAIDAYLLAPLQLGLDNLSGRRKNLKSSDFVVGDKLGEGSYGVVYSGVLLPKNVNVNVNVNVEEERVQKKRGGRGKAAITTQLDVKSKDKVILKKLTNGICRLRLEFEELKNLVILRNGSITGSLEQRPKHALTSLELS*
• ORF Type: complete

Annotations of Ll_transcript_177151

• Blastp: Serine/threonine-protein kinase STN8, chloroplastic from Arabidopsis with 40.95% of identity
• Blastx: Serine/threonine-protein kinase STN8, chloroplastic from Arabidopsis with 82.9% of identity
• Eggnog: Cyclin-Dependent Kinase(ENOG410XPP3)
• Kegg: Link to kegg annotations (AT5G01920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464052.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;