Protein coding transcript 253770

• Transcript: Ll_transcript_177135
• CDS coordinates: 2069-2452 (-)
• Peptide sequence: MESHIEDAEKYLEMPVIFAEFGVSSKDPGYNSSYRDNLINTVYKTILNSTKKGGSGAGSLVWQLFPDGTDYMDDGYAIILSKSPSTSSMISLQSTRLDIFNSVCSKRCHWGCKKKNVFQKVFYRDEL*
• ORF Type: complete

Annotations of Ll_transcript_177135

• Blastp: Mannan endo-1,4-beta-mannosidase 6 from Arabidopsis with 62.02% of identity
• Blastx: Mannan endo-1,4-beta-mannosidase 6 from Arabidopsis with 60% of identity
• Eggnog: Mannan endo-1,4-beta-mannosidase(COG3934)
• Kegg: Link to kegg annotations (AT5G01930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464058.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;