Transcript | Ll_transcript_177140 |
---|---|
CDS coordinates | 123-833 (+) |
Peptide sequence | MNIMASLLSPTTILKQHNQMTICFSPLKPTLPTYNNNVSFKSTSNSSKCHAFFDDISNGLLENGVIQSGIVQFERVTEDLSDMQRWSFVIFGGLTWIYLTARPGVLVGAIDAYLLAPLQLGLDNLSGRRKNLKSSDFVVGDKLGEGSYGVVYSGVLLPKNVNVNVNVNVEEERVQKKRGGRGKAAITTQLDVKSKDKVILKKVSLPCFSFSYPIQTSPSSFGFGFDMKLEFDMTIF* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase STN8, chloroplastic from Arabidopsis with 54.07% of identity |
---|---|
Blastx | Serine/threonine-protein kinase STN8, chloroplastic from Arabidopsis with 82.9% of identity |
Eggnog | Cyclin-Dependent Kinase(ENOG410XPP3) |
Kegg | Link to kegg annotations (AT5G01920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464052.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer