Protein coding transcript 2538

• Transcript: Ll_transcript_328961
• CDS coordinates: 2-631 (+)
• Peptide sequence: NSSFSPQYFQTELLDSNRMVSTHNSVFSTKLELPSNQYSQPQMQQEIKHDIDFNDPTLQTSSGLLGDLLFEAQAIASGQNSKKRNYLSLNEGNDVFDGYQNFDDWPLCSNYWSSSSGVKRKEESSDLSKSVNEDMSKLLTGMPSTIQGTDWNNNSAAEVSNNVQSSGVTTDDNFGLDNKPIASLFPLTNTTNHNENQGYYSWDNLPGLC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_328961

• Blastp: Transcription factor MYB97 from Arabidopsis with 31.06% of identity
• Blastx: -
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT4G26930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440734.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;