Protein coding transcript 253839

• Transcript: Ll_transcript_177791
• CDS coordinates: 1984-2385 (+)
• Peptide sequence: MEQVLASPVSHVNSNSSSSDPAAPLIISEEIDSGTNIAYAGGINHNSAVNSHELRLLEINTLEWDDLVLANDLNTSTVTNGGKVQDFDQQNQVLLNNSFNNPVASNRSAEIPSFDYLTQPIDASTSVPYNFSES
• ORF Type: 3prime_partial

Annotations of Ll_transcript_177791

• Blastp: Calmodulin-binding transcription activator 5 from Arabidopsis with 33.33% of identity
• Blastx: Calmodulin-binding transcription activator 5 from Arabidopsis with 84.29% of identity
• Eggnog: Transcription activator(ENOG410XS5M)
• Kegg: Link to kegg annotations (AT4G15200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464816.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;